SCOPe 2.08: Domain d5gs1n_: 5gs1 N:

Lineage for d5gs1n_ (5gs1 N:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)

8. Domain d5gs1n_: 5gs1 N: [323928]
   Other proteins in same PDB: d5gs1a_, d5gs1c1, d5gs1c2, d5gs1d1, d5gs1d2, d5gs1e1, d5gs1e2, d5gs1f1, d5gs1f2, d5gs1g1, d5gs1h1, d5gs1i1, d5gs1i2, d5gs1j1, d5gs1j2, d5gs1k1, d5gs1k2, d5gs1l1, d5gs1l2, d5gs1m_, d5gs1o_, d5gs1q_
   automated match to d1t2ja_

Details for d5gs1n_

PDB Entry: 5gs1, 2 Å

PDB Description: crystal structure of homo-specific diabody

PDB Compounds: (N:) heavy chain

SCOPe Domain Sequences for d5gs1n_:

Sequence; same for both SEQRES and ATOM records:

>d5gs1n_ b.1.1.1 (N:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vqlvesggglvqpggslrlscaasgftfrnsamhwvrqapgkglewvssiwysgsntyya
dsvkgrftisrdnskntlylqmnsltaedtavyycarfaggwgaydvwgqgtlvtvss

Timeline for d5gs1n_:

• d5gs1n_ first appeared in SCOPe 2.06
  
• d5gs1n_ appears in SCOPe 2.07