Lineage for d5gs3a2 (5gs3 A:125-231)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. Protein automated matches [190740] (30 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1747 PDB entries)
  8. Domain d5gs3a2: 5gs3 A:125-231 [323926]
    automated match to d1c1eh1

Details for d5gs3a2

PDB Entry: 5gs3 (more details), 1.7000000000000002 Å

PDB Description: crystal structure of diabody
PDB Compounds: (A:) diabody protein

SCOPe Domain Sequences for d5gs3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gs3a2 b.1.1.0 (A:125-231) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspsslsasvgdrvtitcrasqsiglylawyqqkpgkapklliyaasslqsgvps
rfsgsgsgtdftltisslqpedfatyycqqgntlsytfgqgtkveik

SCOPe Domain Coordinates for d5gs3a2 are not available.

Timeline for d5gs3a2:

Domains from same chain:
(mouse over for more information)
d5gs3a1
Domains from other chains:
(mouse over for more information)
d5gs3h1, d5gs3h2