SCOPe 2.06: Domain d5gs3a1: 5gs3 A:2-119

Lineage for d5gs3a1 (5gs3 A:2-119)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)

8. Domain d5gs3a1: 5gs3 A:2-119 [323925]
   automated match to d1c1eh1

Details for d5gs3a1

PDB Entry: 5gs3, 1.7 Å

PDB Description: crystal structure of diabody

PDB Compounds: (A:) diabody protein

SCOPe Domain Sequences for d5gs3a1:

Sequence, based on SEQRES records:

>d5gs3a1 b.1.1.0 (A:2-119) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vqlvesggglvqpggslrlscaasgftfrnsamhwvrqapgkglewvssiwysgsntyya
dsvkgrftisrdnskntlylqmnsltaedtavyycarfaggwgaydvwgqgtlvtvss

Sequence, based on observed residues (ATOM records):

>d5gs3a1 b.1.1.0 (A:2-119) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vqlvesggglvqpggslrlscaasgftfrnsamhwvrqapgkglewvssiwysntyyads
vkgrftisrdnskntlylqmnsltaedtavyycarfaggwgaydvwgqgtlvtvss

Timeline for d5gs3a1:

• d5gs3a1 is new in SCOPe 2.06-stable
  
• d5gs3a1 appears in SCOPe 2.07
  
• d5gs3a1 appears in the current release, SCOPe 2.08