Lineage for d5gs3a1 (5gs3 A:2-119)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2754889Domain d5gs3a1: 5gs3 A:2-119 [323925]
    automated match to d1c1eh1

Details for d5gs3a1

PDB Entry: 5gs3 (more details), 1.7 Å

PDB Description: crystal structure of diabody
PDB Compounds: (A:) diabody protein

SCOPe Domain Sequences for d5gs3a1:

Sequence, based on SEQRES records: (download)

>d5gs3a1 b.1.1.0 (A:2-119) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vqlvesggglvqpggslrlscaasgftfrnsamhwvrqapgkglewvssiwysgsntyya
dsvkgrftisrdnskntlylqmnsltaedtavyycarfaggwgaydvwgqgtlvtvss

Sequence, based on observed residues (ATOM records): (download)

>d5gs3a1 b.1.1.0 (A:2-119) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vqlvesggglvqpggslrlscaasgftfrnsamhwvrqapgkglewvssiwysntyyads
vkgrftisrdnskntlylqmnsltaedtavyycarfaggwgaydvwgqgtlvtvss

SCOPe Domain Coordinates for d5gs3a1:

Click to download the PDB-style file with coordinates for d5gs3a1.
(The format of our PDB-style files is described here.)

Timeline for d5gs3a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5gs3a2