Lineage for d5i38a_ (5i38 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719416Fold a.86: Di-copper centre-containing domain [48055] (1 superfamily)
    multihelical
  4. 2719417Superfamily a.86.1: Di-copper centre-containing domain [48056] (4 families) (S)
    duplication: contains two structural repeats
  5. 2719484Family a.86.1.0: automated matches [254307] (1 protein)
    not a true family
  6. 2719485Protein automated matches [254708] (4 species)
    not a true protein
  7. 2719486Species Bacillus megaterium [TaxId:1404] [255981] (21 PDB entries)
  8. 2719525Domain d5i38a_: 5i38 A: [323924]
    automated match to d4p6ra_
    complexed with cu, koj

Details for d5i38a_

PDB Entry: 5i38 (more details), 2.6 Å

PDB Description: crystal structure of tyrosinase from bacillus megaterium with inhibitor kojic acid in the active site
PDB Compounds: (A:) tyrosinase

SCOPe Domain Sequences for d5i38a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5i38a_ a.86.1.0 (A:) automated matches {Bacillus megaterium [TaxId: 1404]}
yrvrknvlhltdtekrdfvrtvlilkekgiydryiawhgaagkfhtppgsdrnaahmssa
flpwhreyllrferdlqsinpevtlpywewetdaqmqdpsqsqiwsadfmggngnpikdf
ivdtgpfaagrwttideqgnpsgglkrnfgatkeaptlptrddvlnalkitqydtppwdm
tsqnsfrnqlegfingpqlhnrvhrwvggqmgvvptapndpvfflhhanvdriwavwqii
hrnqnyqpmkngpfgqnfrdpmypwnttpedvmnhrklgyvydiel

SCOPe Domain Coordinates for d5i38a_:

Click to download the PDB-style file with coordinates for d5i38a_.
(The format of our PDB-style files is described here.)

Timeline for d5i38a_: