![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.26: SMAD/FHA domain [49878] (1 superfamily) sandwich; 11 strands in 2 sheets; greek-key |
![]() | Superfamily b.26.1: SMAD/FHA domain [49879] (5 families) ![]() has a few short helices inserted in loops |
![]() | Family b.26.1.1: SMAD domain [49880] (5 proteins) |
![]() | Protein automated matches [323874] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [323875] (2 PDB entries) |
![]() | Domain d5c4vc_: 5c4v C: [323917] automated match to d1u7vb_ complexed with gol, ni, zn |
PDB Entry: 5c4v (more details), 2.6 Å
SCOPe Domain Sequences for d5c4vc_:
Sequence, based on SEQRES records: (download)
>d5c4vc_ b.26.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} apeywcsiayfemdvqvgetfkvpsscpivtvdgyvdpsggdrfclgqlsnvhrteaier arlhigkgvqleckgegdvwvrclsdhavfvqsyyldreagrapgdavhkiypsayikvf dlrqchrqmqqqaataqaaaaaqaaavagnipgpgsvggiapaislsaaagigvddlrrl cilrmsfvkgwgpdyprqsiketpcwieihlhralqlldevlht
>d5c4vc_ b.26.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} apeywcsiayfemdvqvgetfkvpsscpivtvdgyvdpsggdrfclgqlsnvhrteaier arlhigkgvqleckgegdvwvrclsdhavfvqsyyldreagrapgdavhkiypsayikvf dlrqchrqmqqqaataqvddlrrlcilrmsfvkgwgpdyprqsiketpcwieihlhralq lldevlht
Timeline for d5c4vc_: