SCOPe 2.08: Domain d5gruh2: 5gru H:135-241

Lineage for d5gruh2 (5gru H:135-241)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d5gruh2: 5gru H:135-241 [323911]
   Other proteins in same PDB: d5grua_
   automated match to d1f3rb2

Details for d5gruh2

PDB Entry: 5gru, 1.96 Å

PDB Description: structure of mono-specific diabody

PDB Compounds: (H:) diabody protein

SCOPe Domain Sequences for d5gruh2:

Sequence; same for both SEQRES and ATOM records:

>d5gruh2 b.1.1.0 (H:135-241) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqltqstsslpaslgdrvtiscragqdisnhlnwyqqkpdgtvklliyytsrlhsgvps
rfsgsgsgtdysltisnleqediatyfcqqgntlpwtfgggskleik

Timeline for d5gruh2:

• d5gruh2 first appeared in SCOPe 2.06
  
• d5gruh2 appears in SCOPe 2.07