Lineage for d5hp8a_ (5hp8 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958618Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2958619Superfamily d.79.1: YjgF-like [55298] (4 families) (S)
    forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)
  5. 2958881Family d.79.1.0: automated matches [191544] (1 protein)
    not a true family
  6. 2958882Protein automated matches [190935] (24 species)
    not a true protein
  7. 2959068Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [323904] (2 PDB entries)
  8. 2959070Domain d5hp8a_: 5hp8 A: [323905]
    automated match to d3l7qa_
    complexed with pyr

Details for d5hp8a_

PDB Entry: 5hp8 (more details), 2.3 Å

PDB Description: crystal structures of rida in complex with pyruvate
PDB Compounds: (A:) Reactive Intermediate Deaminase A, chloroplastic

SCOPe Domain Sequences for d5hp8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hp8a_ d.79.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
sqaikannlvflsgvlglipetgkfvsesvedqteqvlknmgeilkasgadyssvvktti
mladladfktvneiyakyfpapsparstyqvaalplnakieieciatl

SCOPe Domain Coordinates for d5hp8a_:

Click to download the PDB-style file with coordinates for d5hp8a_.
(The format of our PDB-style files is described here.)

Timeline for d5hp8a_: