| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.1: YjgF-like [55298] (4 families) ![]() forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1) |
| Family d.79.1.0: automated matches [191544] (1 protein) not a true family |
| Protein automated matches [190935] (24 species) not a true protein |
| Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [323904] (2 PDB entries) |
| Domain d5hp8a_: 5hp8 A: [323905] automated match to d3l7qa_ complexed with pyr |
PDB Entry: 5hp8 (more details), 2.3 Å
SCOPe Domain Sequences for d5hp8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5hp8a_ d.79.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
sqaikannlvflsgvlglipetgkfvsesvedqteqvlknmgeilkasgadyssvvktti
mladladfktvneiyakyfpapsparstyqvaalplnakieieciatl
Timeline for d5hp8a_: