| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
| Protein Immunoreceptor CTLA-4 (CD152), N-terminal fragment [48939] (2 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [48941] (3 PDB entries) |
| Domain d5e5me_: 5e5m E: [323901] Other proteins in same PDB: d5e5mb_, d5e5md_, d5e5mf_, d5e5mh_ automated match to d1dqta_ complexed with gol |
PDB Entry: 5e5m (more details), 2.18 Å
SCOPe Domain Sequences for d5e5me_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5e5me_ b.1.1.1 (E:) Immunoreceptor CTLA-4 (CD152), N-terminal fragment {Mouse (Mus musculus) [TaxId: 10090]}
iqvtqpsvvlasshgvasfpceyspshntdevrvtvlrqtndqmtevcattftekntvgf
ldypfcsgtfnesrvnltiqglravdtglylckvelmypppyfvgmgngtqiyvi
Timeline for d5e5me_: