![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins) there are two additional subdomains inserted into the central core that has a RecA-like topology missing some secondary structures that made up less than one-third of the common domain |
![]() | Protein DNA repair protein MutS, the C-terminal domain [52697] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [52699] (8 PDB entries) Uniprot P23909 2-800 |
![]() | Domain d1e3mb2: 1e3m B:567-800 [32390] Other proteins in same PDB: d1e3ma1, d1e3ma3, d1e3ma4, d1e3mb1, d1e3mb3, d1e3mb4 complexed with adp, mg |
PDB Entry: 1e3m (more details), 2.2 Å
SCOPe Domain Sequences for d1e3mb2:
Sequence, based on SEQRES records: (download)
>d1e3mb2 c.37.1.12 (B:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} ytcptfidkpgiritegrhpvveqvlnepfianplnlspqrrmliitgpnmggkstymrq talialmayigsyvpaqkveigpidriftrvgaaddlasgrstfmvemtetanilhnate yslvlmdeigrgtstydglslawacaenlankikaltlfathyfeltqlpekmegvanvh ldalehgdtiafmhsvqdgaasksyglavaalagvpkevikrarqklrelesis
>d1e3mb2 c.37.1.12 (B:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} ytcptfidkpgiritegrhpvveqvlnepfianplnlspqrrmliitgpnmggkstymrq talialmayigsyvpaqkveigpidriftrvgtfmvemtetanilhnateyslvlmdeig rgtstydglslawacaenlankikaltlfathyfeltqlpekmegvanvhldalehgdti afmhsvqdgaasksyglavaalagvpkevikrarqklrelesis
Timeline for d1e3mb2:
![]() Domains from other chains: (mouse over for more information) d1e3ma1, d1e3ma2, d1e3ma3, d1e3ma4 |