| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
| Protein automated matches [190056] (195 species) not a true protein |
| Species Pacific white shrimp (Litopenaeus vannamei) [TaxId:6689] [323880] (1 PDB entry) |
| Domain d5an1d1: 5an1 D:2-85 [323887] Other proteins in same PDB: d5an1a2, d5an1b2, d5an1c2, d5an1d2, d5an1e2, d5an1f2, d5an1g2, d5an1h2 automated match to d3crta1 complexed with gsh |
PDB Entry: 5an1 (more details), 2 Å
SCOPe Domain Sequences for d5an1d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5an1d1 c.47.1.0 (D:2-85) automated matches {Pacific white shrimp (Litopenaeus vannamei) [TaxId: 6689]}
lpvlgywktralcqpirlmlgytgtefeeknypvgdapdydksewlavkfklglafpnlp
yyidgdvkitqskaimrylarkhg
Timeline for d5an1d1: