Lineage for d1ewrb2 (1ewr B:1542-1762)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 483669Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 483670Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) (S)
    division into families based on beta-sheet topologies
  5. 485179Family c.37.1.12: ABC transporter ATPase domain-like [52686] (17 proteins)
    there are two additional subdomains inserted into the central core that has a RecA-like topology
  6. 485217Protein DNA repair protein MutS, the C-terminal domain [52697] (2 species)
  7. 485233Species Thermus aquaticus [TaxId:271] [52698] (4 PDB entries)
  8. 485241Domain d1ewrb2: 1ewr B:1542-1762 [32388]
    Other proteins in same PDB: d1ewra1, d1ewra3, d1ewrb1, d1ewrb3

Details for d1ewrb2

PDB Entry: 1ewr (more details), 3.19 Å

PDB Description: crystal structure of taq muts

SCOP Domain Sequences for d1ewrb2:

Sequence, based on SEQRES records: (download)

>d1ewrb2 c.37.1.12 (B:1542-1762) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus}
yvrprfgdrlqiragrhpvverrtefvpndlemahelvlitgpnmagkstflrqtalial
laqvgsfvpaeeahlplfdgiytrigasddlaggkstfmvemeevalilkeatenslvll
devgrgtssldgvaiatavaealherraytlfathyfeltalglprlknlhvaareeagg
lvfyhqvlpgpasksygvevaamaglpkevvararallqam

Sequence, based on observed residues (ATOM records): (download)

>d1ewrb2 c.37.1.12 (B:1542-1762) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus}
yvrprfgdrlqiragrhpvverrtefvpndlemahelvlitgpnmagkstflrqtalial
laqvgsfvpaeeahlplfdgiytrigagkstfmvemeevalilkeatenslvlldevgrg
tssldgvaiatavaealherraytlfathyfeltalglprlknlhvaareeagglvfyhq
vlpgpasksygvevaamaglpkevvararallqam

SCOP Domain Coordinates for d1ewrb2:

Click to download the PDB-style file with coordinates for d1ewrb2.
(The format of our PDB-style files is described here.)

Timeline for d1ewrb2: