Lineage for d1ewrb2 (1ewr B:1542-1762)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22942Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 22943Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) (S)
  5. 23620Family c.37.1.12: ABC transporter ATPase domain-like [52686] (6 proteins)
  6. 23627Protein DNA repair protein MutS, the C-terminal domain [52697] (2 species)
  7. 23631Species Thermus aquaticus [TaxId:271] [52698] (3 PDB entries)
  8. 23637Domain d1ewrb2: 1ewr B:1542-1762 [32388]
    Other proteins in same PDB: d1ewra1, d1ewra3, d1ewrb1, d1ewrb3

Details for d1ewrb2

PDB Entry: 1ewr (more details), 3.19 Å

PDB Description: crystal structure of taq muts
PDB Compounds: (B:)

SCOP Domain Sequences for d1ewrb2:

Sequence, based on SEQRES records: (download)

>d1ewrb2 c.37.1.12 (B:1542-1762) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus}
yvrprfgdrlqiragrhpvverrtefvpndlemahelvlitgpnmagkstflrqtalial
laqvgsfvpaeeahlplfdgiytrigasddlaggkstfmvemeevalilkeatenslvll
devgrgtssldgvaiatavaealherraytlfathyfeltalglprlknlhvaareeagg
lvfyhqvlpgpasksygvevaamaglpkevvararallqam

Sequence, based on observed residues (ATOM records): (download)

>d1ewrb2 c.37.1.12 (B:1542-1762) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus}
yvrprfgdrlqiragrhpvverrtefvpndlemahelvlitgpnmagkstflrqtalial
laqvgsfvpaeeahlplfdgiytrigagkstfmvemeevalilkeatenslvlldevgrg
tssldgvaiatavaealherraytlfathyfeltalglprlknlhvaareeagglvfyhq
vlpgpasksygvevaamaglpkevvararallqam

SCOP Domain Coordinates for d1ewrb2:

Click to download the PDB-style file with coordinates for d1ewrb2.
(The format of our PDB-style files is described here.)

Timeline for d1ewrb2: