![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein Immunoreceptor CTLA-4 (CD152), N-terminal fragment [48939] (2 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [48941] (3 PDB entries) |
![]() | Domain d5e5ma_: 5e5m A: [323879] Other proteins in same PDB: d5e5mb_, d5e5md_, d5e5mf_, d5e5mh_ automated match to d1dqta_ complexed with gol |
PDB Entry: 5e5m (more details), 2.18 Å
SCOPe Domain Sequences for d5e5ma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5e5ma_ b.1.1.1 (A:) Immunoreceptor CTLA-4 (CD152), N-terminal fragment {Mouse (Mus musculus) [TaxId: 10090]} iqvtqpsvvlasshgvasfpceyspshntdevrvtvlrqtndqmtevcattftekntvgf ldypfcsgtfnesrvnltiqglravdtglylckvelmypppyfvgmgngtqiyvi
Timeline for d5e5ma_: