Lineage for d5t4hb2 (5t4h B:509-766)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2901917Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2901918Protein automated matches [190543] (131 species)
    not a true protein
  7. 2902215Species Human (Homo sapiens) [TaxId:9606] [188340] (99 PDB entries)
  8. 2902322Domain d5t4hb2: 5t4h B:509-766 [323861]
    Other proteins in same PDB: d5t4ha1, d5t4ha3, d5t4hb1, d5t4hb3
    automated match to d1orva2
    complexed with 75j, na, nag

Details for d5t4hb2

PDB Entry: 5t4h (more details), 2.61 Å

PDB Description: human dpp4 in complex with ligand 34n
PDB Compounds: (B:) dipeptidyl peptidase 4

SCOPe Domain Sequences for d5t4hb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t4hb2 c.69.1.0 (B:509-766) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mpskkldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatyla
steniivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwg
wsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstv
msraenfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstah
qhiythmshfikqcfslp

SCOPe Domain Coordinates for d5t4hb2:

Click to download the PDB-style file with coordinates for d5t4hb2.
(The format of our PDB-style files is described here.)

Timeline for d5t4hb2: