Lineage for d5b13b_ (5b13 B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2302308Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
    automatically mapped to Pfam PF00502
  6. 2302507Protein automated matches [190531] (20 species)
    not a true protein
  7. 2302587Species Palmaria palmata [TaxId:2822] [323523] (1 PDB entry)
  8. 2302589Domain d5b13b_: 5b13 B: [323859]
    automated match to d1eyxa_
    complexed with cyc, pub

Details for d5b13b_

PDB Entry: 5b13 (more details), 2.09 Å

PDB Description: crystal structure of phycoerythrin
PDB Compounds: (B:) Phycoerythrin alpha subunit

SCOPe Domain Sequences for d5b13b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b13b_ a.1.1.3 (B:) automated matches {Palmaria palmata [TaxId: 2822]}
mksvmtttisaadaagrfpsssdlesvqgniqraaarleaaeklasnheavvkeggdacf
akysylknpgeagdsqekvnkcyrdvdhymrlvnyslvvggtgpldewaiagarevyrtl
nlpsasyvaafaftrdrlcvprdmsaqaggeyvaaldyivnalt

SCOPe Domain Coordinates for d5b13b_:

Click to download the PDB-style file with coordinates for d5b13b_.
(The format of our PDB-style files is described here.)

Timeline for d5b13b_: