Lineage for d5tf5a_ (5tf5 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2896671Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2896672Protein automated matches [190151] (166 species)
    not a true protein
  7. 2897228Species Human (Homo sapiens) [TaxId:9606] [188446] (28 PDB entries)
  8. 2897248Domain d5tf5a_: 5tf5 A: [323854]
    automated match to d1wsta1
    complexed with 7ar

Details for d5tf5a_

PDB Entry: 5tf5 (more details), 1.81 Å

PDB Description: crystal structure of human kat-2 in complex with a reversible inhibitor
PDB Compounds: (A:) kynurenine/alpha-aminoadipate aminotransferase, mitochondrial

SCOPe Domain Sequences for d5tf5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tf5a_ c.67.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mnyarfitaasaarnpspirtmtdilsrgpksmislagglpnpnmfpfktavitvengkt
iqfgeemmkralqyspsagipellswlkqlqiklhnpptihyppsqgqmdlcvtsgsqqg
lckvfemiinpgdnvlldepaysgtlqslhplgcniinvasdesgivpdslrdilsrwkp
edaknpqkntpkflytvpngnnptgnsltserkkeiyelarkydfliieddpyyflqfnk
frvptflsmdvdgrviradsfskiissglrigfltgpkpliervilhiqvstlhpstfnq
lmisqllhewgeegfmahvdrvidfysnqkdailaaadkwltglaewhvpaagmflwikv
kgindvkelieekavkmgvlmlpgnafyvdssapspylrasfssaspeqmdvafqvlaql
ikesl

SCOPe Domain Coordinates for d5tf5a_:

Click to download the PDB-style file with coordinates for d5tf5a_.
(The format of our PDB-style files is described here.)

Timeline for d5tf5a_: