| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
| Family c.55.1.1: Actin/HSP70 [53068] (8 proteins) |
| Protein automated matches [226905] (13 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [225574] (54 PDB entries) |
| Domain d5aqha2: 5aqh A:189-381 [323839] automated match to d1atra2 complexed with dms, gol, zvo |
PDB Entry: 5aqh (more details), 2 Å
SCOPe Domain Sequences for d5aqha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5aqha2 c.55.1.1 (A:189-381) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vgaernvlifdlgggtfdvsiltiedgifevkstagdthlggedfdnrmvnhfiaefkrk
hkkdisenkravrrlrtacerakrtlssstqasieidslyegidfytsitrarfeelnad
lfrgtldpvekalrdakldksqihdivlvggstripkiqkllqdffngkelnksinpdea
vaygaavqaails
Timeline for d5aqha2: