Lineage for d5sx4i2 (5sx4 I:107-213)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2025133Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2029182Protein automated matches [190374] (16 species)
    not a true protein
  7. 2029210Species Human (Homo sapiens) [TaxId:9606] [187221] (698 PDB entries)
  8. 2030322Domain d5sx4i2: 5sx4 I:107-213 [323836]
    Other proteins in same PDB: d5sx4i1, d5sx4m1, d5sx4m2, d5sx4m3, d5sx4n1, d5sx4n2, d5sx4n3
    automated match to d1dn0a2
    complexed with 1pe, edo, gol, so4

Details for d5sx4i2

PDB Entry: 5sx4 (more details), 2.8 Å

PDB Description: crystal structure of panitumumab in complex with epidermal growth factor receptor domain 3.
PDB Compounds: (I:) Panitumumab Fab Light Chain

SCOPe Domain Sequences for d5sx4i2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5sx4i2 b.1.1.2 (I:107-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

SCOPe Domain Coordinates for d5sx4i2:

Click to download the PDB-style file with coordinates for d5sx4i2.
(The format of our PDB-style files is described here.)

Timeline for d5sx4i2: