Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (16 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (698 PDB entries) |
Domain d5sx4i2: 5sx4 I:107-213 [323836] Other proteins in same PDB: d5sx4i1, d5sx4m1, d5sx4m2, d5sx4m3, d5sx4n1, d5sx4n2, d5sx4n3 automated match to d1dn0a2 complexed with 1pe, edo, gol, so4 |
PDB Entry: 5sx4 (more details), 2.8 Å
SCOPe Domain Sequences for d5sx4i2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5sx4i2 b.1.1.2 (I:107-213) automated matches {Human (Homo sapiens) [TaxId: 9606]} krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge
Timeline for d5sx4i2: