![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (31 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
![]() | Domain d5sx4i1: 5sx4 I:1-106 [323835] Other proteins in same PDB: d5sx4h2, d5sx4i2, d5sx4j2, d5sx4l2, d5sx4m1, d5sx4m2, d5sx4m3, d5sx4n1, d5sx4n2, d5sx4n3 automated match to d1dn0a1 complexed with 1pe, edo, gol, so4 |
PDB Entry: 5sx4 (more details), 2.8 Å
SCOPe Domain Sequences for d5sx4i1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5sx4i1 b.1.1.0 (I:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]} diqmtqspsslsasvgdrvtitcqasqdisnylnwyqqkpgkapklliydasnletgvps rfsgsgsgtdftftisslqpediatyfcqhfdhlplafgggtkvei
Timeline for d5sx4i1: