Lineage for d1ewqa2 (1ewq A:542-765)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 393331Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 393332Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) (S)
    division into families based on beta-sheet topologies
  5. 394686Family c.37.1.12: ABC transporter ATPase domain-like [52686] (16 proteins)
    there are two additional subdomains inserted into the central core that has a RecA-like topology
  6. 394724Protein DNA repair protein MutS, the C-terminal domain [52697] (2 species)
  7. 394738Species Thermus aquaticus [TaxId:271] [52698] (4 PDB entries)
  8. 394739Domain d1ewqa2: 1ewq A:542-765 [32383]
    Other proteins in same PDB: d1ewqa1, d1ewqa3, d1ewqa4, d1ewqb1, d1ewqb3, d1ewqb4

Details for d1ewqa2

PDB Entry: 1ewq (more details), 2.2 Å

PDB Description: crystal structure taq muts complexed with a heteroduplex dna at 2.2 a resolution

SCOP Domain Sequences for d1ewqa2:

Sequence, based on SEQRES records: (download)

>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus}
yvrprfgdrlqiragrhpvverrtefvpndlemahelvlitgpnmagkstflrqtalial
laqvgsfvpaeeahlplfdgiytrigasddlaggkstfmvemeevalilkeatenslvll
devgrgtssldgvaiatavaealherraytlfathyfeltalglprlknlhvaareeagg
lvfyhqvlpgpasksygvevaamaglpkevvararallqamaar

Sequence, based on observed residues (ATOM records): (download)

>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus}
yvrprfgdrlqiragrhpvverrtefvpndlemahelvlitgpnmagkstflrqtalial
laqvgsfvpaeeahlplfdgiytrigagkstfmvemeevalilkeatenslvlldevgrg
tssldgvaiatavaealherraytlfathyfeltalglprlknlhvaareeagglvfyhq
vlpgpasksygvevaamaglpkevvararallqamaar

SCOP Domain Coordinates for d1ewqa2:

Click to download the PDB-style file with coordinates for d1ewqa2.
(The format of our PDB-style files is described here.)

Timeline for d1ewqa2: