![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
![]() | Superfamily d.17.1: Cystatin/monellin [54403] (7 families) ![]() has a additional strand at the N-terminus |
![]() | Family d.17.1.1: Monellin [54404] (2 proteins) |
![]() | Protein automated matches [190339] (1 species) not a true protein |
![]() | Species Serendipity berry (Dioscoreophyllum cumminsii) [TaxId:3457] [187163] (15 PDB entries) |
![]() | Domain d5lc7a_: 5lc7 A: [323825] automated match to d1m9ga_ mutant |
PDB Entry: 5lc7 (more details), 1.55 Å
SCOPe Domain Sequences for d5lc7a_:
Sequence, based on SEQRES records: (download)
>d5lc7a_ d.17.1.1 (A:) automated matches {Serendipity berry (Dioscoreophyllum cumminsii) [TaxId: 3457]} geweiidigpftqnlgkfavdeqnkigkygrltfnkvirpsmkktiyenegfreikgyey qlyvrasdklfradisedyktrgrkllrfngpvppp
>d5lc7a_ d.17.1.1 (A:) automated matches {Serendipity berry (Dioscoreophyllum cumminsii) [TaxId: 3457]} geweiidigpftqnlgkfavdeqnkigkygrltfnkvirpsmkktikgyeyqlyvrasdk lfradisedyktrgrkllrfngpvppp
Timeline for d5lc7a_: