SCOPe 2.08: Domain d5ikha1: 5ikh A:13-220

Lineage for d5ikha1 (5ikh A:13-220)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
   multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies

4. Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families)

5. Family a.102.4.0: automated matches [227201] (1 protein)
   not a true family

6. Protein automated matches [226931] (12 species)
   not a true protein

7. Species Tobacco (Nicotiana tabacum) [TaxId:4097] [225865] (22 PDB entries)

8. Domain d5ikha1: 5ikh A:13-220 [323823]
   Other proteins in same PDB: d5ikha2
   automated match to d3lz9a1
   complexed with 6bw, mg; mutant

Details for d5ikha1

PDB Entry: 5ikh, 2.1 Å

PDB Description: tobacco 5-epi-aristolochene synthase m4 mutant with (-)- premnaspirodiene

PDB Compounds: (A:) 5-epi-aristolochene synthase

SCOPe Domain Sequences for d5ikha1:

Sequence; same for both SEQRES and ATOM records:

>d5ikha1 a.102.4.0 (A:13-220) automated matches {Tobacco (Nicotiana tabacum) [TaxId: 4097]}
ivrpvadfspslwgdqflsfsiknqvaekyakeiealkeqtrnmllatgmkladtlnlid
tierlgisyhfekeiddildqiynqnsncndlctsalqfrllrqhgfnispeifskfqde
ngkfkeslasdvlgllnlyeashvrthaddiledalafstihlesaaphlksplreqvth
aleqclhkgvprvetrffissiydkeqs

Timeline for d5ikha1:

• d5ikha1 first appeared in SCOPe 2.06
  
• d5ikha1 appears in SCOPe 2.07