SCOPe 2.08: Domain d1qhla_: 1qhl A:

Lineage for d1qhla_ (1qhl A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins)
   there are two additional subdomains inserted into the central core that has a RecA-like topology
   missing some secondary structures that made up less than one-third of the common domain
   

6. Protein Cell division protein MukB [52695] (1 species)

7. Species Escherichia coli [TaxId:562] [52696] (1 PDB entry)

8. Domain d1qhla_: 1qhl A: [32382]
   N-terminal (sub)domain only; in the absence of the C-terminal domain complementing the central core structure, the P-loop region folds in a helix-loop-helix structure
   fragment; missing more than one-third of the common structure and/or sequence

Details for d1qhla_

PDB Entry: 1qhl, 2.2 Å

PDB Description: crystal structure of the n-terminal domain of mukb at 2.2a resolution

PDB Compounds: (A:) protein (cell division protein mukb)

SCOPe Domain Sequences for d1qhla_:

Sequence, based on SEQRES records:

>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]}
rgkfrsltlinwngffartfdldelvttlsggngagksttmaafvtalipdltllhfrnt
teagatsgsrdkglhgklkagvcysmldtinsrhqrvvvgvrlqqvagrdrkvdikpfai
qglpmsvqptqlvtetlnerqarvlplnelkdkleamegvqfkqfnsitdyhslmfdlgi
iarrlrsasdrskfyrlieaslyggissaitrslrdyllpen

Sequence, based on observed residues (ATOM records):

>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]}
rgkfrsltlinwngffartfdldelvttlsggngagksttmaafvtalipdltlllhgkl
kagvcysmldtinsrhqrvvvgvrlqqvagrdrkvdikpfaiqglpmsvqptqlvtetln
erqarvlplnelkdkleamegvqfkqfnsitdyhslmfdlgiiarrlrsasdrskfyrli
easlyggissaitrslrdyllpen

Timeline for d1qhla_:

• d1qhla_ first appeared (with stable ids) in SCOP 1.55
  
• d1qhla_ appears in SCOPe 2.07