Lineage for d5sx5l2 (5sx5 L:107-212)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2751578Domain d5sx5l2: 5sx5 L:107-212 [323810]
    Other proteins in same PDB: d5sx5h1, d5sx5h2, d5sx5j1, d5sx5j2, d5sx5k1, d5sx5l1, d5sx5m1, d5sx5m2, d5sx5m3, d5sx5m4, d5sx5n1, d5sx5n2, d5sx5n3
    automated match to d1dn0a2
    complexed with 1pe, edo, gol, so4; mutant

Details for d5sx5l2

PDB Entry: 5sx5 (more details), 2.5 Å

PDB Description: crystal structure of panitumumab in complex with epidermal growth factor receptor domain 3 mutant s468r.
PDB Compounds: (L:) Panitumumab Fab Light Chain

SCOPe Domain Sequences for d5sx5l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5sx5l2 b.1.1.2 (L:107-212) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

SCOPe Domain Coordinates for d5sx5l2:

Click to download the PDB-style file with coordinates for d5sx5l2.
(The format of our PDB-style files is described here.)

Timeline for d5sx5l2: