Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
Domain d5sx5l1: 5sx5 L:1-106 [323809] Other proteins in same PDB: d5sx5h2, d5sx5j2, d5sx5k2, d5sx5l2, d5sx5m1, d5sx5m2, d5sx5m3, d5sx5m4, d5sx5n1, d5sx5n2, d5sx5n3 automated match to d1dn0a1 complexed with 1pe, edo, gol, so4; mutant |
PDB Entry: 5sx5 (more details), 2.5 Å
SCOPe Domain Sequences for d5sx5l1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5sx5l1 b.1.1.0 (L:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]} diqmtqspsslsasvgdrvtitcqasqdisnylnwyqqkpgkapklliydasnletgvps rfsgsgsgtdftftisslqpediatyfcqhfdhlplafgggtkvei
Timeline for d5sx5l1: