SCOPe 2.08: Domain d5sx5k2: 5sx5 K:107-213

Lineage for d5sx5k2 (5sx5 K:107-213)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d5sx5k2: 5sx5 K:107-213 [323802]
   Other proteins in same PDB: d5sx5h1, d5sx5h2, d5sx5j1, d5sx5j2, d5sx5k1, d5sx5l1, d5sx5m1, d5sx5m2, d5sx5m3, d5sx5m4, d5sx5n1, d5sx5n2, d5sx5n3
   automated match to d1dn0a2
   complexed with 1pe, edo, gol, so4; mutant

Details for d5sx5k2

PDB Entry: 5sx5, 2.5 Å

PDB Description: crystal structure of panitumumab in complex with epidermal growth factor receptor domain 3 mutant s468r.

PDB Compounds: (K:) Panitumumab Fab Light Chain

SCOPe Domain Sequences for d5sx5k2:

Sequence; same for both SEQRES and ATOM records:

>d5sx5k2 b.1.1.2 (K:107-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

Timeline for d5sx5k2:

• d5sx5k2 first appeared in SCOPe 2.06
  
• d5sx5k2 appears in SCOPe 2.07