Lineage for d5te9a_ (5te9 A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2438294Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2438295Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2438674Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 2438675Protein automated matches [190131] (73 species)
    not a true protein
  7. 2438890Species Paraburkholderia phymatum [TaxId:391038] [323794] (1 PDB entry)
  8. 2438891Domain d5te9a_: 5te9 A: [323795]
    automated match to d1jlkb_

Details for d5te9a_

PDB Entry: 5te9 (more details), 2.4 Å

PDB Description: crystal structure of a response regulator receiver protein from burkholderia phymatum
PDB Compounds: (A:) Response regulator receiver protein

SCOPe Domain Sequences for d5te9a_:

Sequence, based on SEQRES records: (download)

>d5te9a_ c.23.1.0 (A:) automated matches {Paraburkholderia phymatum [TaxId: 391038]}
dlihillvedsptdvmitreafdyykllnplhvagdgvaameflrregqhsdaprpglii
ldlnlpkksgrevlqelkadpdlmkipvvvlttskseedvartyglhancyitkpvdftr
fvevvrrisdfwfgvvtlp

Sequence, based on observed residues (ATOM records): (download)

>d5te9a_ c.23.1.0 (A:) automated matches {Paraburkholderia phymatum [TaxId: 391038]}
dlihillvedsptdvmitreafdyykllnplhvagdgvaameflrregqhsdaprpglii
ldlnlpkksgrevlqelkadpdlmkipvvvlttskseedvartygancyitkpvdftrfv
evvrrisdfwfgvvtlp

SCOPe Domain Coordinates for d5te9a_:

Click to download the PDB-style file with coordinates for d5te9a_.
(The format of our PDB-style files is described here.)

Timeline for d5te9a_: