SCOPe 2.07: Domain d5t4fa1: 5t4f A:40-508

Lineage for d5t4fa1 (5t4f A:40-508)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
   consists of eight 4-stranded beta-sheet motifs; meander
   also found in some members of the WD40-repeat superfamily

4. Superfamily b.70.3: DPP6 N-terminal domain-like [82171] (1 family)
   automatically mapped to Pfam PF00930

5. Family b.70.3.1: DPP6 N-terminal domain-like [82172] (3 proteins)
   Pfam PF00930

6. Protein Dipeptidyl peptidase IV/CD26, N-terminal domain [82173] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82174] (98 PDB entries)
   Uniprot P27487 39-776 ! Uniprot P27487 ! Uniprot P27487

8. Domain d5t4fa1: 5t4f A:40-508 [323786]
   Other proteins in same PDB: d5t4fa2, d5t4fa3, d5t4fb2, d5t4fb3
   automated match to d1orva1
   complexed with 75m, na, nag

Details for d5t4fa1

PDB Entry: 5t4f, 1.9 Å

PDB Description: human dpp4 in complex with ligand 34p

PDB Compounds: (A:) dipeptidyl peptidase 4

SCOPe Domain Sequences for d5t4fa1:

Sequence; same for both SEQRES and ATOM records:

>d5t4fa1 b.70.3.1 (A:40-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
rktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfdefg
hsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtwsp
vghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwspn
gtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslssv
tnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwnc
lvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfitk
gtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyysv
sfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvq

Timeline for d5t4fa1:

• d5t4fa1 first appeared in SCOPe 2.06
  
• d5t4fa1 appears in the current release, SCOPe 2.08