Lineage for d5t4fa1 (5t4f A:40-508)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2399926Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
    consists of eight 4-stranded beta-sheet motifs; meander
    also found in some members of the WD40-repeat superfamily
  4. 2400039Superfamily b.70.3: DPP6 N-terminal domain-like [82171] (1 family) (S)
    automatically mapped to Pfam PF00930
  5. 2400040Family b.70.3.1: DPP6 N-terminal domain-like [82172] (3 protein domains)
    Pfam PF00930
  6. 2400047Protein Dipeptidyl peptidase IV/CD26, N-terminal domain [82173] (2 species)
  7. 2400048Species Human (Homo sapiens) [TaxId:9606] [82174] (94 PDB entries)
    Uniprot P27487 39-776 ! Uniprot P27487 ! Uniprot P27487
  8. 2400095Domain d5t4fa1: 5t4f A:40-508 [323786]
    Other proteins in same PDB: d5t4fa2, d5t4fa3, d5t4fb2, d5t4fb3
    automated match to d1orva1
    complexed with 75m, na, nag

Details for d5t4fa1

PDB Entry: 5t4f (more details), 1.9 Å

PDB Description: human dpp4 in complex with ligand 34p
PDB Compounds: (A:) dipeptidyl peptidase 4

SCOPe Domain Sequences for d5t4fa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t4fa1 b.70.3.1 (A:40-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
rktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfdefg
hsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtwsp
vghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwspn
gtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslssv
tnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwnc
lvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfitk
gtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyysv
sfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvq

SCOPe Domain Coordinates for d5t4fa1:

Click to download the PDB-style file with coordinates for d5t4fa1.
(The format of our PDB-style files is described here.)

Timeline for d5t4fa1: