Lineage for d1e69c_ (1e69 C:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22942Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 22943Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) (S)
  5. 23620Family c.37.1.12: ABC transporter ATPase domain-like [52686] (6 protein domains)
  6. Protein Smc head domain [52693] (1 species)
  7. Species Thermotoga maritima [TaxId:243274] [52694] (1 PDB entry)
  8. Domain d1e69c_: 1e69 C: [32378]

Details for d1e69c_

PDB Entry: 1e69 (more details), 3.1 Å

PDB Description: smc head domain from thermotoga maritima

SCOP Domain Sequences for d1e69c_:

Sequence, based on SEQRES records: (download)

>d1e69c_ c.37.1.12 (C:) Smc head domain {Thermotoga maritima}
mrlkklylkgfksfgrpsligfsdrvtaivgpngsgksniidaikwvfgeqskkelrase
kfdmifagsenlppagsayvelvfeengeeitvarelkrtgentyylngspvrlkdirdr
fagtglgvdfysivgqgqidrivnaspeelrlesskhptslvprgsyqrvnesfnrfisl
lffggegrlnivseaksildagfeisirkpgrrdqklsllsggekalvglallfalmeik
pspfyvldevdsplddynaerfkrllkenskhtqfivithnkivmeaadllhgvtmvngv
saivpvev

Sequence, based on observed residues (ATOM records): (download)

>d1e69c_ c.37.1.12 (C:) Smc head domain {Thermotoga maritima}
mrlkklylkgfksfgrpsligfsdrvtaivgpngsgksniidaikwvfgekfdmifagse
nlppagsayvelvfeengeeitvarelkrtgentyylngspvrlkdirdrfagtglgvdf
ysivgqgqidrivnayqrvnesfnrfisllffggegrleisirkpgrrdqklsllsggek
alvglallfalmeikpspfyvldevdsplddynaerfkrllkenskhtqfivithnkivm
eaadllhgvtmvngvsaivpvev

SCOP Domain Coordinates for d1e69c_ are not available.

Timeline for d1e69c_:

Domains from other chains:
(mouse over for more information)
d1e69a_, d1e69b_, d1e69d_, d1e69e_, d1e69f_