SCOPe 2.07: Domain d5lp0a1: 5lp0 A:18-152

Lineage for d5lp0a1 (5lp0 A:18-152)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.9: ENTH/VHS domain [48464] (5 families)

5. Family a.118.9.1: ENTH domain [48465] (2 proteins)
   automatically mapped to Pfam PF01417

6. Protein automated matches [323717] (1 species)
   not a true protein

7. Species Zebrafish (Danio rerio) [TaxId:7955] [323718] (1 PDB entry)

8. Domain d5lp0a1: 5lp0 A:18-152 [323773]
   Other proteins in same PDB: d5lp0a2, d5lp0b2
   automated match to d1edua_
   complexed with po4

Details for d5lp0a1

PDB Entry: 5lp0, 1.41 Å

PDB Description: crystal structure of the zebra fish enth domain from epsin1 in 1.41 angstrom resolution

PDB Compounds: (A:) Epsin 1

SCOPe Domain Sequences for d5lp0a1:

Sequence; same for both SEQRES and ATOM records:

>d5lp0a1 a.118.9.1 (A:18-152) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
seaeikvreatsndpwgpssslmseiadltynvvafseimsmvwkrlndhgknwrhvyka
mtlmeyliktgservaqqcreniyavqtlkdfqyidrdgkdqgvnvrekakqlvtllkde
erlreerihalktke

Timeline for d5lp0a1:

• d5lp0a1 first appeared in SCOPe 2.06
  
• d5lp0a1 appears in the current release, SCOPe 2.08