Lineage for d1e69b_ (1e69 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2870122Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins)
    there are two additional subdomains inserted into the central core that has a RecA-like topology
    missing some secondary structures that made up less than one-third of the common domain
  6. 2870384Protein Smc head domain [52693] (3 species)
  7. 2870393Species Thermotoga maritima [TaxId:2336] [52694] (1 PDB entry)
  8. 2870395Domain d1e69b_: 1e69 B: [32377]
    N- and C-terminal subdomains only; the middle coiled coil domain is deleted

Details for d1e69b_

PDB Entry: 1e69 (more details), 3.1 Å

PDB Description: smc head domain from thermotoga maritima
PDB Compounds: (B:) chromosome segregation smc protein

SCOPe Domain Sequences for d1e69b_:

Sequence, based on SEQRES records: (download)

>d1e69b_ c.37.1.12 (B:) Smc head domain {Thermotoga maritima [TaxId: 2336]}
mrlkklylkgfksfgrpsligfsdrvtaivgpngsgksniidaikwvfgeqskkelrase
kfdmifagsenlppagsayvelvfeengeeitvarelkrtgentyylngspvrlkdirdr
fagtglgvdfysivgqgqidrivnaspeelrlesskhptslvprgsyqrvnesfnrfisl
lffggegrlnivseaksildagfeisirkpgrrdqklsllsggekalvglallfalmeik
pspfyvldevdsplddynaerfkrllkenskhtqfivithnkivmeaadllhgvtmvngv
saivpvev

Sequence, based on observed residues (ATOM records): (download)

>d1e69b_ c.37.1.12 (B:) Smc head domain {Thermotoga maritima [TaxId: 2336]}
mrlkklylkgfksfgrpsligfsdrvtaivgpngsgksniidaikwvfgekfdmifagse
nlppagsayvelvfeengeeitvarelkrtgentyylngspvrlkdirdrfagtglgvdf
ysivgqgqidrivnayqrvnesfnrfisllffggegrleisirkpgrrdqklsllsggek
alvglallfalmeikpspfyvldevdsplddynaerfkrllkenskhtqfivithnkivm
eaadllhgvtmvngvsaivpvev

SCOPe Domain Coordinates for d1e69b_:

Click to download the PDB-style file with coordinates for d1e69b_.
(The format of our PDB-style files is described here.)

Timeline for d1e69b_: