SCOPe 2.08: Domain d5lc7b_: 5lc7 B:

Lineage for d5lc7b_ (5lc7 B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.1: Cystatin/monellin [54403] (7 families)
   has a additional strand at the N-terminus

5. Family d.17.1.1: Monellin [54404] (2 proteins)

6. Protein automated matches [190339] (1 species)
   not a true protein

7. Species Serendipity berry (Dioscoreophyllum cumminsii) [TaxId:3457] [187163] (15 PDB entries)

8. Domain d5lc7b_: 5lc7 B: [323767]
   automated match to d1m9ga_
   mutant

Details for d5lc7b_

PDB Entry: 5lc7, 1.55 Å

PDB Description: crystal structure of a single chain monellin mutant: e23q/q28k/c41s/y65r-mnei

PDB Compounds: (B:) Monellin chain B,Monellin chain A

SCOPe Domain Sequences for d5lc7b_:

Sequence; same for both SEQRES and ATOM records:

>d5lc7b_ d.17.1.1 (B:) automated matches {Serendipity berry (Dioscoreophyllum cumminsii) [TaxId: 3457]}
mgeweiidigpftqnlgkfavdeqnkigkygrltfnkvirpsmkktiyenegfreikgye
yqlyvrasdklfradisedyktrgrkllrfngpvppp

Timeline for d5lc7b_:

• d5lc7b_ first appeared in SCOPe 2.06
  
• d5lc7b_ appears in SCOPe 2.07