Lineage for d5lqua_ (5lqu A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2145089Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2145090Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2145091Family c.66.1.1: COMT-like [53336] (4 proteins)
  6. 2145102Protein Catechol O-methyltransferase, COMT [53337] (2 species)
  7. 2145115Species Norway rat (Rattus norvegicus) [TaxId:10116] [53338] (84 PDB entries)
  8. 2145177Domain d5lqua_: 5lqu A: [323766]
    automated match to d1h1da_
    complexed with 619, btb, cl, mg

Details for d5lqua_

PDB Entry: 5lqu (more details), 1.8 Å

PDB Description: crystal structure of comt in complex with n-[(e)-3-[(2r,3s,4r,5r)-5- [6-(ethylamino)purin-9-yl]-3,4-dihydroxyoxolan-2-yl]prop-2-enyl]-5- (4-fluorophenyl)-2,3-dihydroxybenzamide
PDB Compounds: (A:) Catechol O-methyltransferase

SCOPe Domain Sequences for d5lqua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lqua_ c.66.1.1 (A:) Catechol O-methyltransferase, COMT {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dtkeqrilryvqqnakpgdpqsvleaidtyctqkewamnvgdakgqimdavireyspslv
lelgaycgysavrmarllqpgarlltmemnpdyaaitqqmlnfaglqdkvtilngasqdl
ipqlkkkydvdtldmvfldhwkdrylpdtlllekcgllrkgtvlladnvivpgtpdflay
vrgsssfecthyssyleymkvvdglekaiyqgp

SCOPe Domain Coordinates for d5lqua_:

Click to download the PDB-style file with coordinates for d5lqua_.
(The format of our PDB-style files is described here.)

Timeline for d5lqua_: