Lineage for d5l90a1 (5l90 A:21-404)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330957Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2330958Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2331668Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2331669Protein automated matches [190847] (73 species)
    not a true protein
  7. 2331691Species Bacillus megaterium [TaxId:592022] [323682] (5 PDB entries)
  8. 2331698Domain d5l90a1: 5l90 A:21-404 [323757]
    Other proteins in same PDB: d5l90a2, d5l90b2
    automated match to d4rm4a_
    complexed with hem

Details for d5l90a1

PDB Entry: 5l90 (more details), 2.55 Å

PDB Description: the crystal structure of substrate-free cyp109e1 from bacillus megaterium at 2.55 angstrom resolution
PDB Compounds: (A:) cytochrome p450

SCOPe Domain Sequences for d5l90a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l90a1 a.104.1.0 (A:21-404) automated matches {Bacillus megaterium [TaxId: 592022]}
erfnpfswyeemrntapvqwdeerqvwdvfhydgvkevleqknifssdrrppqnqrqtal
gtslinidppkhaemralvnkaftpkamkawepkiaritnellqevehledidivehlsy
plpvmviadilgvpiedqrqfkdwsdiivagpsnneretleklqqekmkandeletyfyr
iieekrtrpgddiisvllqakeegkqltdeeivgfsillliagnetttnlisntiyclme
dkasferlkrekellpsgieevlryrspvqalhrivkedvtlagkklkagehvvpwmgsa
hrdaeyfedpevfkidrkpnvhmafgrgihfclgaplarieakimlaelidrypqmdwsp
sfelkpiestfvyglkellirknv

SCOPe Domain Coordinates for d5l90a1:

Click to download the PDB-style file with coordinates for d5l90a1.
(The format of our PDB-style files is described here.)

Timeline for d5l90a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5l90a2