Lineage for d5tevb_ (5tev B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2442470Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2442471Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2443142Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2443143Protein automated matches [190459] (53 species)
    not a true protein
  7. 2443366Species Neisseria gonorrhoeae [TaxId:242231] [323751] (2 PDB entries)
  8. 2443368Domain d5tevb_: 5tev B: [323756]
    automated match to d3prha_

Details for d5tevb_

PDB Entry: 5tev (more details), 2.25 Å

PDB Description: crystal structure of a tryptophanyl-trna synthetase from neisseria gonorrhoeae, apo
PDB Compounds: (B:) Tryptophan--tRNA ligase

SCOPe Domain Sequences for d5tevb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tevb_ c.26.1.0 (B:) automated matches {Neisseria gonorrhoeae [TaxId: 242231]}
skkrvltgvtttgtphlgnyvgairpavraaqnpdtesflfladyhgiikcheqemihqs
tqavaatwlacgldperttfyrqsdipevmelnwiltcitakglmnrahaykaavqanae
ngqedpdfgvemglfsypilmtadilmfnanevpvgrdqiqhvemardiagrfnhrfqel
ftlpevkidenvellvgldgrkmsksygntiplwendkktqksvnkiitnmkepgepkqp
desplfeiykafstpsetaeftqmladglawgeakklsaakinaelaelrerynaltsnp
sqieeilqagaqkarkearelldkvrdavgirplk

SCOPe Domain Coordinates for d5tevb_:

Click to download the PDB-style file with coordinates for d5tevb_.
(The format of our PDB-style files is described here.)

Timeline for d5tevb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5teva_