SCOPe 2.08: Domain d5ijvl2: 5ijv L:108-211

Lineage for d5ijvl2 (5ijv L:108-211)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [226022] (18 PDB entries)

8. Domain d5ijvl2: 5ijv L:108-211 [323748]
   automated match to d4k3dl2

Details for d5ijvl2

PDB Entry: 5ijv, 2.2 Å

PDB Description: crystal structure of bovine fab e03

PDB Compounds: (L:) bovine Fab E03 light chain

SCOPe Domain Sequences for d5ijvl2:

Sequence; same for both SEQRES and ATOM records:

>d5ijvl2 b.1.1.0 (L:108-211) automated matches {Cow (Bos taurus) [TaxId: 9913]}
qpksppsvtlfppsteelngnkatlvclisdfypgsvtvvwkadgstitrnvettraskq
snskyaassylsltssdwkskgsyscevthegstvtktvkpsec

Timeline for d5ijvl2:

• d5ijvl2 first appeared in SCOPe 2.06
  
• d5ijvl2 appears in SCOPe 2.07