Lineage for d5l92a_ (5l92 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330957Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2330958Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2331668Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2331669Protein automated matches [190847] (73 species)
    not a true protein
  7. 2331691Species Bacillus megaterium [TaxId:592022] [323682] (5 PDB entries)
  8. 2331692Domain d5l92a_: 5l92 A: [323746]
    automated match to d4rm4a_
    complexed with c0r, hem, mla

Details for d5l92a_

PDB Entry: 5l92 (more details), 2.1 Å

PDB Description: the 2.1 a crystal structure of cyp109e1 from bacillus megaterium in complex with corticosterone
PDB Compounds: (A:) cytochrome p450

SCOPe Domain Sequences for d5l92a_:

Sequence, based on SEQRES records: (download)

>d5l92a_ a.104.1.0 (A:) automated matches {Bacillus megaterium [TaxId: 592022]}
iqtkeerfnpfswyeemrntapvqwdeerqvwdvfhydgvkevleqknifssdrrppqnq
rqtalgtslinidppkhaemralvnkaftpkamkawepkiaritnellqevehledidiv
ehlsyplpvmviadilgvpiedqrqfkdwsdiivagpsnneretleklqqekmkandele
tyfyriieekrtrpgddiisvllqakeegkqltdeeivgfsillliagnetttnlisnti
yclmedkasferlkrekellpsgieevlryrspvqalhrivkedvtlagkklkagehvvp
wmgsahrdaeyfedpevfkidrkpnvhmafgrgihfclgaplarieakimlaelidrypq
mdwspsfelkpiestfvyglkellirknv

Sequence, based on observed residues (ATOM records): (download)

>d5l92a_ a.104.1.0 (A:) automated matches {Bacillus megaterium [TaxId: 592022]}
iqtkeerfnpfswyeemrntapvqwdeerqvwdvfhydgvkevleqknifssdrrpqrqt
algtslinidppkhaemralvnkaftpkamkawepkiaritnellqevehledidivehl
syplpvmviadilgvpiedqrqfkdwsdiivagpsnneretleklqqekmkandeletyf
yriieekrtrpgddiisvllqakeegkqltdeeivgfsillliagnetttnlisntiycl
medkasferlkrekellpsgieevlryrspvqalhrivkedvtlagkklkagehvvpwmg
sahrdaeyfedpevfkidrkpnvhmafgrgihfclgaplarieakimlaelidrypqmdw
spsfelkpiestfvyglkellirknv

SCOPe Domain Coordinates for d5l92a_:

Click to download the PDB-style file with coordinates for d5l92a_.
(The format of our PDB-style files is described here.)

Timeline for d5l92a_: