Lineage for d5aqva2 (5aqv A:189-381)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2883384Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2883385Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 2883861Protein automated matches [226905] (13 species)
    not a true protein
  7. 2883942Species Human (Homo sapiens) [TaxId:9606] [225574] (54 PDB entries)
  8. 2883988Domain d5aqva2: 5aqv A:189-381 [323742]
    automated match to d1atra2
    complexed with dms, gol, kc7, trs

Details for d5aqva2

PDB Entry: 5aqv (more details), 1.75 Å

PDB Description: fragment-based screening of hsp70 sheds light on the functional role of atp-binding site residues
PDB Compounds: (A:) Heat shock cognate 71 kDa protein

SCOPe Domain Sequences for d5aqva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5aqva2 c.55.1.1 (A:189-381) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vgaernvlifdlgggtfdvsiltiedgifevkstagdthlggedfdnrmvnhfiaefkrk
hkkdisenkravrrlrtacerakrtlssstqasieidslyegidfytsitrarfeelnad
lfrgtldpvekalrdakldksqihdivlvggstripkiqkllqdffngkelnksinpdea
vaygaavqaails

SCOPe Domain Coordinates for d5aqva2:

Click to download the PDB-style file with coordinates for d5aqva2.
(The format of our PDB-style files is described here.)

Timeline for d5aqva2: