Lineage for d5lp0c_ (5lp0 C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2727055Superfamily a.118.9: ENTH/VHS domain [48464] (5 families) (S)
  5. 2727056Family a.118.9.1: ENTH domain [48465] (2 proteins)
    automatically mapped to Pfam PF01417
  6. 2727064Protein automated matches [323717] (1 species)
    not a true protein
  7. 2727065Species Zebrafish (Danio rerio) [TaxId:7955] [323718] (1 PDB entry)
  8. 2727068Domain d5lp0c_: 5lp0 C: [323740]
    Other proteins in same PDB: d5lp0a2, d5lp0b2
    automated match to d1edua_
    complexed with po4

Details for d5lp0c_

PDB Entry: 5lp0 (more details), 1.41 Å

PDB Description: crystal structure of the zebra fish enth domain from epsin1 in 1.41 angstrom resolution
PDB Compounds: (C:) Epsin 1

SCOPe Domain Sequences for d5lp0c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lp0c_ a.118.9.1 (C:) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
eaeikvreatsndpwgpssslmseiadltynvvafseimsmvwkrlndhgknwrhvykam
tlmeyliktgservaqqcreniyavqtlkdfqyidrdgkdqgvnvrekakqlvtllkdee
rlreerihalktkekmaq

SCOPe Domain Coordinates for d5lp0c_:

Click to download the PDB-style file with coordinates for d5lp0c_.
(The format of our PDB-style files is described here.)

Timeline for d5lp0c_: