SCOP 1.69: Domain d1f2u.1: 1f2u A:,B:

Lineage for d1f2u.1 (1f2u A:,B:)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.12: ABC transporter ATPase domain-like [52686] (17 proteins)
   there are two additional subdomains inserted into the central core that has a RecA-like topology

6. Protein Rad50 [52691] (1 species)

7. Species Archaeon Pyrococcus furiosus [TaxId:2261] [52692] (4 PDB entries)

8. Domain d1f2u.1: 1f2u A:,B: [32374]

Details for d1f2u.1

PDB Entry: 1f2u, 1.6 Å

PDB Description: crystal structure of rad50 abc-atpase

SCOP Domain Sequences for d1f2u.1:

Sequence; same for both SEQRES and ATOM records:

>g1f2u.1 c.37.1.12 (A:,B:) Rad50 {Archaeon Pyrococcus furiosus}
mklervtvknfrshsdtvvefkeginliigqngsgksslldailvglywplrikdikkde
ftkvgardtyidlifekdgtkyritrrflkgyssgeihamkrlvgnewkhvtepsskais
afmeklipyniflnaiyirqgqidailesXalareaalskigelaseifaeftegkysev
vvraeenkvrlfvvwegkerpltflsggerialglafrlamslylageisllildeptpy
ldeerrrklitimerylkkipqvilvshdeelkdaadhvirislengsskvevvs

Timeline for d1f2u.1:

• d1f2u.1 first appeared (with stable ids) in SCOP 1.55
  
• d1f2u.1 appears in SCOP 1.67
  
• d1f2u.1 appears in SCOP 1.71
  
• d1f2u.1 appears in the current release, SCOPe 2.08