Lineage for d5lqub_ (5lqu B:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. Family c.66.1.1: COMT-like [53336] (4 proteins)
  6. Protein Catechol O-methyltransferase, COMT [53337] (2 species)
  7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [53338] (87 PDB entries)
  8. Domain d5lqub_: 5lqu B: [323739]
    automated match to d1h1da_
    complexed with 619, btb, cl, mg

Details for d5lqub_

PDB Entry: 5lqu (more details), 1.8 Å

PDB Description: crystal structure of comt in complex with n-[(e)-3-[(2r,3s,4r,5r)-5- [6-(ethylamino)purin-9-yl]-3,4-dihydroxyoxolan-2-yl]prop-2-enyl]-5- (4-fluorophenyl)-2,3-dihydroxybenzamide
PDB Compounds: (B:) Catechol O-methyltransferase

SCOPe Domain Sequences for d5lqub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lqub_ c.66.1.1 (B:) Catechol O-methyltransferase, COMT {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gdtkeqrilryvqqnakpgdpqsvleaidtyctqkewamnvgdakgqimdavireyspsl
vlelgaycgysavrmarllqpgarlltmemnpdyaaitqqmlnfaglqdkvtilngasqd
lipqlkkkydvdtldmvfldhwkdrylpdtlllekcgllrkgtvlladnvivpgtpdfla
yvrgsssfecthyssyleymkvvdglekaiyqgp

SCOPe Domain Coordinates for d5lqub_ are not available.

Timeline for d5lqub_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5lqua_