| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies) 2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies |
Superfamily c.10.2: L domain-like [52058] (9 families) ![]() less regular structure consisting of variable repeats |
| Family c.10.2.5: L domain [52071] (6 proteins) this is a repeat family; one repeat unit is 1n8z C:42-66 found in domain |
| Protein automated matches [232361] (1 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [232384] (6 PDB entries) |
| Domain d5sx4n1: 5sx4 N:311-480 [323725] Other proteins in same PDB: d5sx4h1, d5sx4h2, d5sx4i1, d5sx4i2, d5sx4j1, d5sx4j2, d5sx4l1, d5sx4l2, d5sx4m2, d5sx4m3, d5sx4n2, d5sx4n3 automated match to d3p0ya1 complexed with 1pe, edo, gol, so4 |
PDB Entry: 5sx4 (more details), 2.8 Å
SCOPe Domain Sequences for d5sx4n1:
Sequence, based on SEQRES records: (download)
>d5sx4n1 c.10.2.5 (N:311-480) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kvcngigigefkdslsidatnikhfknctsisgdlhilpvafrgdsfthtppldpqeldi
lktvkeitgflliqawpenrtdlhafenleiirgrtkqhgqfslavvslditslglrslk
eisdgdviisgnknlcyantinwkklfgtsgqktkiisnrgensckatgq
>d5sx4n1 c.10.2.5 (N:311-480) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kvcnfkdslsidatnikhfknctsisgdlhilpvafrgdsfthtppldpqeldilktvke
itgflliqawpenrtdlhafenleiirgrtkqhgqfslavvslditslglrslkeisdgd
viisgnknlcyantinwkklfgtsgqktkiisnrgensckatgq
Timeline for d5sx4n1: