Lineage for d5lnga_ (5lng A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2767182Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2767438Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 2767842Family b.2.3.0: automated matches [191391] (1 protein)
    not a true family
  6. 2767843Protein automated matches [190503] (10 species)
    not a true protein
  7. 2767867Species Escherichia coli [TaxId:562] [187451] (6 PDB entries)
  8. 2767873Domain d5lnga_: 5lng A: [323722]
    automated match to d4csta_
    complexed with so4

Details for d5lnga_

PDB Entry: 5lng (more details), 2.09 Å

PDB Description: lectin domain of e. coli f9 pilus adhesin fmlh
PDB Compounds: (A:) Putative Fml fimbrial adhesin FmlD

SCOPe Domain Sequences for d5lnga_:

Sequence, based on SEQRES records: (download)

>d5lnga_ b.2.3.0 (A:) automated matches {Escherichia coli [TaxId: 562]}
fscnvdggssigagttsvyvnldpviqpgqnlvvdlsqhiscwndyggwydtdhinlvqg
safagslqsykgslywnnvtypfplttntnvldigdktpmplplklyitpvgaaggvvik
ageviarihmykiatlgsgnprnftwniisnnsvvmp

Sequence, based on observed residues (ATOM records): (download)

>d5lnga_ b.2.3.0 (A:) automated matches {Escherichia coli [TaxId: 562]}
fscnvdggssigagttsvyvnldpviqpgqnlvvdlsqhiscwndyggwydtdhinlvqg
safagslqsykgslywnnvtypfplttntnvldigdktpmplplklyitpgvvikagevi
arihmykiatlgsgnprnftwniisnnsvvmp

SCOPe Domain Coordinates for d5lnga_:

Click to download the PDB-style file with coordinates for d5lnga_.
(The format of our PDB-style files is described here.)

Timeline for d5lnga_: