| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.9: ENTH/VHS domain [48464] (5 families) ![]() |
| Family a.118.9.1: ENTH domain [48465] (2 proteins) automatically mapped to Pfam PF01417 |
| Protein automated matches [323717] (1 species) not a true protein |
| Species Zebrafish (Danio rerio) [TaxId:7955] [323718] (1 PDB entry) |
| Domain d5lp0b1: 5lp0 B:18-152 [323719] Other proteins in same PDB: d5lp0a2, d5lp0b2 automated match to d1edua_ complexed with po4 |
PDB Entry: 5lp0 (more details), 1.41 Å
SCOPe Domain Sequences for d5lp0b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5lp0b1 a.118.9.1 (B:18-152) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
seaeikvreatsndpwgpssslmseiadltynvvafseimsmvwkrlndhgknwrhvyka
mtlmeyliktgservaqqcreniyavqtlkdfqyidrdgkdqgvnvrekakqlvtllkde
erlreerihalktke
Timeline for d5lp0b1:
View in 3DDomains from other chains: (mouse over for more information) d5lp0a1, d5lp0a2, d5lp0c_, d5lp0d_ |