SCOPe 2.08: Domain d5lneb1: 5lne B:1-158

Lineage for d5lneb1 (5lne B:1-158)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.3: Bacterial adhesins [49401] (7 families)

5. Family b.2.3.0: automated matches [191391] (1 protein)
   not a true family

6. Protein automated matches [190503] (10 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [187451] (6 PDB entries)

8. Domain d5lneb1: 5lne B:1-158 [323713]
   Other proteins in same PDB: d5lneb2
   automated match to d4csta_
   complexed with ni

Details for d5lneb1

PDB Entry: 5lne, 2.2 Å

PDB Description: e. coli f9 pilus adhesin fmlh bound to the thomsen-friedenreich (tf) antigen

PDB Compounds: (B:) Putative Fml fimbrial adhesin FmlD

SCOPe Domain Sequences for d5lneb1:

Sequence, based on SEQRES records:

>d5lneb1 b.2.3.0 (B:1-158) automated matches {Escherichia coli [TaxId: 562]}
fscnvdggssigagttsvyvnldpviqpgqnlvvdlsqhiscwndyggwydtdhinlvqg
safagslqsykgslywnnvtypfplttntnvldigdktpmplplklyitpvgaaggvvik
ageviarihmykiatlgsgnprnftwniisnnsvvmpt

Sequence, based on observed residues (ATOM records):

>d5lneb1 b.2.3.0 (B:1-158) automated matches {Escherichia coli [TaxId: 562]}
fscnvdggssigagttsvyvnldpviqpgqnlvvdlsqhiscwndyggwydtdhinlvqg
safaslqsykgslywnnvtypfplttntnvldigdktpmplplklyitpvgaggvvikag
eviarihmykiatlgsgnprnftwniisnnsvvmpt

Timeline for d5lneb1:

• d5lneb1 first appeared in SCOPe 2.06
  
• d5lneb1 appears in SCOPe 2.07