SCOPe 2.08: Domain d5loza1: 5loz A:17-150

Lineage for d5loza1 (5loz A:17-150)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.9: ENTH/VHS domain [48464] (5 families)

5. Family a.118.9.0: automated matches [191620] (1 protein)
   not a true family

6. Protein automated matches [191137] (5 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [323710] (3 PDB entries)

8. Domain d5loza1: 5loz A:17-150 [323711]
   Other proteins in same PDB: d5loza2
   automated match to d1edua_

Details for d5loza1

PDB Entry: 5loz, 1.95 Å

PDB Description: structure of yeast ent1 enth domain

PDB Compounds: (A:) Epsin-1

SCOPe Domain Sequences for d5loza1:

Sequence; same for both SEQRES and ATOM records:

>d5loza1 a.118.9.0 (A:17-150) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
sstqvlvrnatsndnhqvskdslielaeksydsadffeimdmldkrlndkgkywrhiaka
ltvidylirfgsencvlwcrenlyiiktlkefrheddegidqgqivrvkakeltallsdd
erlneernmnikgr

Timeline for d5loza1:

• d5loza1 first appeared in SCOPe 2.06
  
• d5loza1 appears in SCOPe 2.07