SCOPe 2.06: Domain d1g2912: 1g29 1:1-240

Lineage for d1g2912 (1g29 1:1-240)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins)
   there are two additional subdomains inserted into the central core that has a RecA-like topology

6. Protein Maltose transport protein MalK, N-terminal domain [52689] (2 species)

7. Species Thermococcus litoralis [TaxId:2265] [52690] (1 PDB entry)

8. Domain d1g2912: 1g29 1:1-240 [32371]
   Other proteins in same PDB: d1g2913, d1g2914, d1g2923, d1g2924
   CASP4
   complexed with cl, dio, mg, na, nh4, pop

Details for d1g2912

PDB Entry: 1g29, 1.9 Å

PDB Description: malk

PDB Compounds: (1:) maltose transport protein malk

SCOPe Domain Sequences for d1g2912:

Sequence; same for both SEQRES and ATOM records:

>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Thermococcus litoralis [TaxId: 2265]}
magvrlvdvwkvfgevtavremslevkdgefmillgpsgcgktttlrmiagleepsrgqi
yigdklvadpekgifvppkdrdiamvfqsyalyphmtvydniafplklrkvprqeidqrv
revaellgltellnrkprelsggqrqrvalgraivrkpqvflmdeplsnldaklrvrmra
elkklqrqlgvttiyvthdqveamtmgdriavmnrgvlqqvgspdevydkpantfvagfi

Timeline for d1g2912:

• d1g2912 first appeared (with stable ids) in SCOP 1.55
  
• d1g2912 appears in SCOPe 2.05
  
• d1g2912 appears in SCOPe 2.07
  
• d1g2912 appears in the current release, SCOPe 2.08