Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins) there are two additional subdomains inserted into the central core that has a RecA-like topology |
Protein Maltose transport protein MalK, N-terminal domain [52689] (2 species) |
Species Thermococcus litoralis [TaxId:2265] [52690] (1 PDB entry) |
Domain d1g2912: 1g29 1:1-240 [32371] Other proteins in same PDB: d1g2913, d1g2914, d1g2923, d1g2924 CASP4 complexed with cl, dio, mg, na, nh4, pop |
PDB Entry: 1g29 (more details), 1.9 Å
SCOPe Domain Sequences for d1g2912:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Thermococcus litoralis [TaxId: 2265]} magvrlvdvwkvfgevtavremslevkdgefmillgpsgcgktttlrmiagleepsrgqi yigdklvadpekgifvppkdrdiamvfqsyalyphmtvydniafplklrkvprqeidqrv revaellgltellnrkprelsggqrqrvalgraivrkpqvflmdeplsnldaklrvrmra elkklqrqlgvttiyvthdqveamtmgdriavmnrgvlqqvgspdevydkpantfvagfi
Timeline for d1g2912: