Lineage for d5jxia2 (5jxi A:443-574)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2369590Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2369591Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2370433Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 2370434Protein automated matches [190770] (38 species)
    not a true protein
  7. 2370641Species Human (Homo sapiens) [TaxId:9606] [188939] (20 PDB entries)
  8. 2370658Domain d5jxia2: 5jxi A:443-574 [323707]
    Other proteins in same PDB: d5jxia1, d5jxia3
    automated match to d1p8ja1
    complexed with ca, cl, na

Details for d5jxia2

PDB Entry: 5jxi (more details), 2 Å

PDB Description: structure of the unliganded form of the proprotein convertase furin in presence of edta.
PDB Compounds: (A:) Furin

SCOPe Domain Sequences for d5jxia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jxia2 b.18.1.0 (A:443-574) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tvapqrkciidiltepkdigkrlevrktvtaclgepnhitrlehaqarltlsynrrgdla
ihlvspmgtrstllaarphdysadgfndwafmtthswdedpsgewvleientseannygt
ltkftlvlygta

SCOPe Domain Coordinates for d5jxia2:

Click to download the PDB-style file with coordinates for d5jxia2.
(The format of our PDB-style files is described here.)

Timeline for d5jxia2: